SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|392383870|ref|YP_005033066.1|NC_016618 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|392383870|ref|YP_005033066.1|NC_016618
Domain Number 1 Region: 5-120
Classification Level Classification E-value
Superfamily CheY-like 2.42e-27
Family CheY-related 0.0012
Further Details:      
 
Domain Number 2 Region: 119-173
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000956
Family FIS-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|392383870|ref|YP_005033066.1|NC_016618
Sequence length 177
Comment two-component response regulator [Azospirillum brasilense Sp245 plasmid AZOBR_p2]
Sequence
METDRSLVLVEDDAAFAKVLRRSFERRGYQVYWCDSLDGLRALLETLPFAYAVVDLKLGN
GSGLECVRELHDNDPETRIVVLTGFASIATAVEAIKLGACHYLAKPSNTDDIEAAFERTE
GDPSIALGARATSLKTLEWERIHETLAETGFNISETARRLGMHRRTLARKLEKKQVP
Download sequence
Identical sequences G8AUE0
WP_014241892.1.1190 gi|392383870|ref|YP_005033066.1| gi|392383870|ref|YP_005033066.1|NC_016618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]