SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|399140263|ref|YP_006546364.1|NC_018265 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|399140263|ref|YP_006546364.1|NC_018265
Domain Number 1 Region: 3-132
Classification Level Classification E-value
Superfamily CheY-like 1.71e-34
Family CheY-related 0.00011
Further Details:      
 
Domain Number 2 Region: 130-229
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 1.22e-26
Family PhoB-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|399140263|ref|YP_006546364.1|NC_018265
Sequence length 231
Comment vancomycin response regulator VanR [Melissococcus plutonius DAT561 plasmid 1]
Sequence
MANGNIVVIDDEKDICDLIVSLLVSEGYTVSSFYTGKNFIEYSEKNEVSLLILDIMLPDI
GGLEILKEIRKRKFFPILLLTAKNLDADKLVGLTLGADDYITKPFNPLEVVARVKTHLRR
VNHYNNQTPEESYLLEYSGLTLNKKKYKIFLFDEEIKVTPIEFAILHYLLINSGRVVTSE
ELFEAVWKEKYMDSNNTIMAHIARIREKLHENPREPNYIKTVWGVGYTIGN
Download sequence
Identical sequences H5T6R8
gi|399140263|ref|YP_006546364.1| WP_014868549.1.26313 gi|399140263|ref|YP_006546364.1|NC_018265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]