SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|400760171|ref|YP_006589774.1|NC_018421 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|400760171|ref|YP_006589774.1|NC_018421
Domain Number 1 Region: 149-332
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.7e-55
Family Methylesterase CheB, C-terminal domain 0.0000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|400760171|ref|YP_006589774.1|NC_018421
Sequence length 334
Comment putative chemotaxis response regulator protein-glutamate methylesterase [Phaeobacter gallaeciensis 2.10 plasmid pPGA2_239]
Sequence
MSQSLLIITTDRRFAQTLQQHMEATYPGLQVLLANNLMMAYNQAEAGQPTFAFVEDGFTK
LPEFEMMLALFSALDIRWVSVMDNQGSTPARNSSPLLDVGAGIFELTKSDNPRDFARYFD
MMVKAPRRDQASPLQKQTAGGTAGPGSDKIILIGSSTGGVEALRSVLVGFPLNCPPTLIV
QHTGKNFGRGLVSLLDRICPAKVLTADDNMTLSPGHVYVAAGQPRHMGMTPRKPYRTRFK
EGPPISGHMPSVDALFMSAVPIAKSVVATILTGMGQDGAQGLLELRKAGAKTFAQDEKSS
VVYGMPRVAWEMGAAQQQVSLARMAGTLIQACKT
Download sequence
Identical sequences A0A2I7I3F7 I7ESE3 I7F2K9
gi|400760171|ref|YP_006589774.1| WP_014881842.1.100387 WP_014881842.1.65966 WP_014881842.1.71111 WP_014881842.1.82519 gi|399994984|ref|YP_006575216.1| gi|399994984|ref|YP_006575216.1|NC_018291 gi|400760171|ref|YP_006589774.1|NC_018421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]