SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|407690229|ref|YP_006813813.1|NC_018683 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407690229|ref|YP_006813813.1|NC_018683
Domain Number 1 Region: 1-141
Classification Level Classification E-value
Superfamily ALDH-like 1.83e-37
Family ALDH-like 0.00025
Further Details:      
 
Weak hits

Sequence:  gi|407690229|ref|YP_006813813.1|NC_018683
Domain Number - Region: 128-180
Classification Level Classification E-value
Superfamily SO2669-like 0.0366
Family SO2669-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|407690229|ref|YP_006813813.1|NC_018683
Sequence length 181
Comment aldehyde dehydrogenase, partial [Sinorhizobium meliloti Rm41 plasmid pSYMA]
Sequence
MIVFDDADMEPMLPVLEKALTVFAGQFCMTGSRLLVQEAVYDTVRDRLAERLRNVRVGPA
SDPKSDMGPLIDKPNVERVDKIVRDAVNAGAKAIVGGGPITDGPLANGAFFRPALLEVSD
NSLPIVQQETFGPVLTIQRFCETEPSRSPTTANTVCPPAFGREIWTARCGSLRRWRWAAS
S
Download sequence
Identical sequences gi|407690229|ref|YP_006813813.1|NC_018683 gi|407690229|ref|YP_006813813.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]