SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|407691091|ref|YP_006814675.1|NC_018683 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407691091|ref|YP_006814675.1|NC_018683
Domain Number 1 Region: 157-344
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 2.88e-61
Family Methylesterase CheB, C-terminal domain 0.000025
Further Details:      
 
Domain Number 2 Region: 1-107
Classification Level Classification E-value
Superfamily CheY-like 0.0000000723
Family CheY-related 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|407691091|ref|YP_006814675.1|NC_018683
Sequence length 354
Comment Chemotaxis response regulator protein-glutamate methylesterase of group 3 operon [Sinorhizobium meliloti Rm41 plasmid pSYMA]
Sequence
MVRILLATSTVELEDLVRRAIEGDASAELVLIARSGREAVRMTGELLPDIVAVELCPSGD
DSAETVREIMIAAPTPVVMLSHRDGSQLGTISARALEAGALAVIPAPAAHGMPLEQPAIE
KFLSTIKAMSQVKVVRQWRQKVRGDRAAKDQPPTARTPIGIVGIAASTGGPAAIRAILKD
ISADLPVPILIVQHMSNGFIDGVAASLNATVPLTVKVARNGELLKPSTVYLAPDNCQLGV
SGRSRLRVSDDAPVNGFKPSGSYLFGSIARAFKGESLAVVLTGMGDDGTEGLRALRMAGG
KAIAQDEKSSVVFGMPKSAIGAGLVDLVLPLESIAENITAIARGRSEPEGETRT
Download sequence
Identical sequences gi|407691091|ref|YP_006814675.1|NC_018683 WP_014990178.1.3038 WP_014990178.1.79107 WP_014990178.1.96031 gi|407691091|ref|YP_006814675.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]