SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|407711167|ref|YP_006835940.1|NC_018696 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407711167|ref|YP_006835940.1|NC_018696
Domain Number 1 Region: 17-200
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 6.93e-51
Family Methylesterase CheB, C-terminal domain 0.00025
Further Details:      
 
Domain Number 2 Region: 1051-1219
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.8e-42
Family Histidine kinase 0.0014
Further Details:      
 
Domain Number 3 Region: 291-485
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 4.45e-42
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.0004
Further Details:      
 
Domain Number 4 Region: 1239-1359
Classification Level Classification E-value
Superfamily CheY-like 7.26e-28
Family CheY-related 0.01
Further Details:      
 
Domain Number 5 Region: 838-965
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 7.93e-20
Family Heme-binding PAS domain 0.015
Further Details:      
 
Domain Number 6 Region: 983-1063
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 2.75e-16
Family Homodimeric domain of signal transducing histidine kinase 0.0019
Further Details:      
 
Domain Number 7 Region: 225-293
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.000000000000314
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0059
Further Details:      
 
Domain Number 8 Region: 745-847
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000464
Family Flavin-binding PAS domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|407711167|ref|YP_006835940.1|NC_018696
Sequence length 1360
Comment signal transduction histidine kinase [Burkholderia phenoliruptrix BR3459a plasmid pSYMBR3459]
Sequence
MSSVTLPTSASAQYPDFAVVGIGASAGGVQALLRFFENAPAPAGMAFVVVLHLSPDYASQ
AHTVIQRATHMPVSQVLEPTPIEKDHVYVIPPGRHLSMIDGYLRVSGHDVSRVPPTSIDV
FFRSLADAHGSRAVGVVLSGTGADGSVGLGRVRERGGITIVQDPDEAEYGEMPRNALATG
MIDLTLPVSQMAARIAELAGKAAQIQLPPASDDVDAGQHAAQPEGSALDAVLALLHERTG
HDFSNYKQGTILRRIERRLQVNGLPNIDAYRDFLAGEVDETPKLLADLLIGVTNFFRDQD
AFAALERVLQQDLARAGSANEEYRAWIPGCATGEEAYSVAMLLAEGFHRTASRNRLAIFA
TDVDERAIGIARMASYPSAIANDVTPERVAKFFVTDGSRLRIAKALRETIIFAAHNILRD
PPFSRLDLISCRNLLIYLDRKAQTYALSLFHFALRPGGILFLGTAESADFAPDRFEVIDR
KHRIYRALPAGASARFGPLDSMWAGTLTGRSYFPVPEPPRAHPPLTLPPPVDRPSEAYGP
PWVVVRPDGTIVQRTATAARLLVGPTHERAGSLLDVVEPGSRERVRKALDESTRCAGRYA
EDDVPLLTAHGRLPFDLTMRRFRHGLSNDMLLSVTLDAVGEPTADLGATVDESQGSLYGS
EEWLQTTLTLAQTSREELRASNEELQAMNEELRSTTEELEASKEELQSLNEELLTVNSEL
QAKAQESAKVSDDLRNLITLVGVATVFVDRLLHIKRFTSPAESLFNIIPSDIGRSLLDLV
NRLDYPELEDDLNSAFEHLRKTEREVRSHDGRWLLARVLPYRTDDDRIDGAILALVDITE
RRKAQQEARLSEERLRMAAQATHDFAIIVTDEEGNIVSWNAGAQRIFGFVADEVMGGPLD
LIFTSADREAGVPALERDRARAGGRAEDERWHATKGGGRVYCSGYLSRIAVAGFSGFAKI
VHDATDRKMAEGRQLRKLAQEREDRARVQEANRLKDEFIAVLSHELKNPLNLVHLKAELL
LRFPETRELPRVQDAAEAIRRSASAQAQLIDDLRDSSRIKTGKLSLHLAPVDIVDIVASL
ADAVKEDAEKAGLTIELHLPQSPLVVRADAVRIEQIAWNLMTNAVKFTPAGGNITVRLEQ
VGNEAHLEVRDTGQGIDPVLLPQVFEMYRQHPAATQRPQAGMGIGLSLVRQLAEMHGGRV
TAHSEGQGRGAAFSVRLPIGASASMHVDPAESNDLASLEGLNILVIDDARDSLDALCQLL
DLLGLHARGASSAEEGREAAGRESFDLVLTDIHMPDIDGFSVSSLLGSTTGAGTAPVIAM
SGDPQPEDEEPLRRAGFSAYLQKPVYFGMLIKAIRKALER
Download sequence
Identical sequences K0DZH7
gi|407711167|ref|YP_006835940.1|NC_018696 WP_015004245.1.42974 gi|407711167|ref|YP_006835940.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]