SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|407723790|ref|YP_006843451.1|NC_018701 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407723790|ref|YP_006843451.1|NC_018701
Domain Number 1 Region: 7-190
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 4.97e-51
Family Methylesterase CheB, C-terminal domain 0.00027
Further Details:      
 
Domain Number 2 Region: 271-449
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 5.9e-46
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00053
Further Details:      
 
Domain Number 3 Region: 827-955
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.65e-20
Family Heme-binding PAS domain 0.025
Further Details:      
 
Domain Number 4 Region: 198-273
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 8.63e-16
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0059
Further Details:      
 
Domain Number 5 Region: 734-836
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000224
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.077
Further Details:      
 
Weak hits

Sequence:  gi|407723790|ref|YP_006843451.1|NC_018701
Domain Number - Region: 604-725
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00126
Family FCH domain 0.025
Further Details:      
 
Domain Number - Region: 1042-1147
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.00351
Family alpha-ketoacid dehydrogenase kinase, C-terminal domain 0.09
Further Details:      
 
Domain Number - Region: 508-608
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0598
Family BphP N-terminal domain-like 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|407723790|ref|YP_006843451.1|NC_018701
Sequence length 1161
Comment methyltransferase [Sinorhizobium meliloti Rm41 plasmid pSYMB]
Sequence
MGRELDPPIVAIGASAGGIQALQTFFDLIPNDTGATFVVIVHLDPHARSELANILAARTR
MSVTQVEDQARLEGNHVYVIAPNRQLKIADGTITALPFEEPHALRAPIDLFFRSLAEEHG
SELAVILTGAGADGAIGVKAVKEAGGIVLVQDPEEAEYASMPRNAIDTEVADFVLPIREL
PHRVAELLADRDQLPSEPFHADDDDMIGRILAHVRGRTGHDFSQYKRATILRRIGRRAQI
ARRETFADYYNYLRENPEEAQALFSDFLISVTTFFRDPSAFEALAERVIPQLFDGKEVAD
AIRVWVPGCATGEETYTMGMLLLEEAARRDLSPEIQVFGSDLDAQALRIAREGRYPSTIE
SDLSEERLRRFFQREGDHYRVRRELRDVVLFASHSLLRDPPFSHLDMISCRNLLIYLDRQ
LQQQVCNTFHYALNAGGFLFLGSSESADHPGLFLTVDREARIYRAVAGGGARRPMVLPAL
LGPHKPEIKSTIIRMPAAGHVSDAAVHRQMLEKIAPPSMLVDESHHAIHLSENAGRFLQP
SGGPVSTDATDLVREEFRFDLRAALHRAIERNEPTLSMPILADLDGQPHRVYLQVKPVVQ
GTERTRHALVLFIEGEAIDKTQEVVLDTLDGRPTIDEAIRRLQEELQLAQNRLRLTSEES
ATATEELRAANEELQSMNEEYRSTAEELETSKEELQSINEELQTVNSELKLKLESISRAH
SDLQNLMAATDIATLFLDPSLRIKRFTPRLTEIFNVTPSDEGRPITDFTHHLKYKRLSDD
ARAVLETLTPVEHEVKSRDDGWYLVRMRPYRTMEDKIDGVVVTFVDISERRHAEEAAKES
GQRLEQEMRLVELSRSPIFVWDFDDGIMQWNRGSEELYGYSREEALGRRKEELLKTAVPG
SSFDKLRRTLSQKGRWSGELNHTTKDGRVLTVESQIELVPFGERRLVLESTRDISDRKRW
ERRGQLLLNELSHRVKNTLAVVQSLARQTLRTTRSSEDFVERFEGRLAALASAHKLLVDS
EWRGAELDALARGQLDAYAGSDRRRLQIEGEPVTLPPDLATPFGLVLHELATNAAKYGAF
STGIGQVRLSWKLGNNGRNLGVIWQERGGPPVEPPSEQGFGGVLIEKSLPGSTVHRDFQP
DGVVCTIDIELPEIPPDGAEK
Download sequence
Identical sequences gi|407723790|ref|YP_006843451.1|NC_018701 WP_015008507.1.3038 WP_015008507.1.55094 WP_015008507.1.96031 gi|407723790|ref|YP_006843451.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]