SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|410683499|ref|YP_006939607.1|NC_018983 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410683499|ref|YP_006939607.1|NC_018983
Domain Number 1 Region: 12-108
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 9.68e-26
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|410683499|ref|YP_006939607.1|NC_018983
Sequence length 115
Comment PTS system, cellobiose-specific IIA component-like protein [Borrelia burgdorferi 297 plasmid 297_cp26]
Sequence
MNKKIYSIEELIDKISMPVVAYSGEAKSFLREALEYAKNKEYDKAELTIQESKKSIAKAH
EAHREIIHQSATNPSSVKTPFILIHAEDHLMSAISELSIFEELINVYKIINEIKK
Download sequence
Identical sequences E4QRP9
WP_012622042.1.66939 WP_012622042.1.70456 gi|219723267|ref|YP_002476680.1|NC_011853 gi|387825559|ref|YP_005804891.1|NC_017395 gi|410683499|ref|YP_006939607.1|NC_018983 gi|387825559|ref|YP_005804891.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]