SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|410685298|ref|YP_006061305.1|NC_017589 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|410685298|ref|YP_006061305.1|NC_017589
Domain Number 1 Region: 182-370
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.2e-72
Family Methylesterase CheB, C-terminal domain 0.000000287
Further Details:      
 
Domain Number 2 Region: 6-111
Classification Level Classification E-value
Superfamily CheY-like 3.7e-27
Family CheY-related 0.00000887
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|410685298|ref|YP_006061305.1|NC_017589
Sequence length 378
Comment chemotactic response regulator; methylesterase, in two-component regulatory system with CheA [Ralstonia solanacearum CMR15 plasmid CMR15_mp]
Sequence
MNEKRKIQVLCIDDSALIRSILKEIINAQPDMEVVGTAPDPIIARDLIKQTNPDVLTLDV
EMPKMDGLDFLEKLMRLRPTPVVMISSLTERGSEATLRALELGAVDFVAKPKLGMRDGMN
EYADQIADKIRAAARAKLRPRTASPAPAAASPAHTVHAVHAVHARPEHDAAVPAPARTHF
SSTEKLIIVGASTGGTEAIKDFLLEMPPDCPGILIVQHMPAGFTTSFAKRLDGLCRIRVK
EAVHGERVLPGHAYIAPGDMHLSLGRSGANYVTELDQNPPVNRHRPAVDVLFRSAARNAG
ANALGVILTGMGKDGAAGMLEMRNAGAYNVAQDEASCVVYGMPKEAVAHGGVHEILPLHQ
IGPHVLARLSAHGRVTRV
Download sequence
Identical sequences D8NET1
WP_014631955.1.86441 gi|410685298|ref|YP_006061305.1| gi|410685298|ref|YP_006061305.1|NC_017589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]