SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|433610686|ref|YP_007194147.1|NC_019849 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|433610686|ref|YP_007194147.1|NC_019849
Domain Number 1 Region: 6-122
Classification Level Classification E-value
Superfamily CheY-like 9.39e-26
Family CheY-related 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|433610686|ref|YP_007194147.1|NC_019849
Sequence length 125
Comment Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Sinorhizobium meliloti GR4 plasmid pRmeGR4d]
Sequence
MHKTRPMIAVVDDDPRLLDSLEELLESAGYTACCFGSASGLLDHGLSNLDLLITDIGMPG
INGFELRDRVKSACPELPVFLTTGRHEIADQGGAQGVNGFFRKPFDAPELLVAVCRALRK
SRDRG
Download sequence
Identical sequences WP_015242916.1.36834 WP_015242916.1.58608 WP_015242916.1.72343 WP_015242916.1.73540 WP_015242916.1.78492 WP_015242916.1.79107 WP_015242916.1.92524 gi|433610686|ref|YP_007194147.1|NC_019849 gi|433610686|ref|YP_007194147.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]