SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|433616049|ref|YP_007192844.1|NC_019848 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|433616049|ref|YP_007192844.1|NC_019848
Domain Number 1 Region: 157-344
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 6.93e-62
Family Methylesterase CheB, C-terminal domain 0.0000226
Further Details:      
 
Domain Number 2 Region: 1-107
Classification Level Classification E-value
Superfamily CheY-like 0.0000000883
Family CheY-related 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|433616049|ref|YP_007192844.1|NC_019848
Sequence length 354
Comment Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain [Sinorhizobium meliloti GR4 plasmid pRmeGR4c]
Sequence
MVRILLATSTVELEDLVKRAIEGDASAELVLIARSGREAVRMTGELLPDIVAVELCPSGD
DSAETVREIMIAAPTPVVMLSHRDGSQLGTISARALEAGALAVIPAPAAHGMPLEQPAIE
KFLSTIKAMSQVKVVRQWRQKVRGDRAAKDQPPTARTPIGIVGIAASTGGPAAIRAILKD
ISADLPVPILIVQHMSNGFIDGVAASLNATVPLTVKVARNGELLKPGTVYLAPDNCQLGV
SGRSRLRVSDDAPVNGFKPSGSYLFGSIARAFKGESLAVVLTGMGDDGTEGLRALRMAGG
KAIAQDEKSSVVFGMPKSAIGAGLVDLVLPLESIAENITAIARGRSEPEGETRT
Download sequence
Identical sequences gi|433616049|ref|YP_007192844.1| WP_015242168.1.18618 WP_015242168.1.36091 WP_015242168.1.92524 gi|433616049|ref|YP_007192844.1|NC_019848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]