SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|45368583|ref|NP_990911.1|NC_005793 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|45368583|ref|NP_990911.1|NC_005793
Domain Number 1 Region: 19-188
Classification Level Classification E-value
Superfamily ClpP/crotonase 0.00000000000000211
Family Biotin dependent carboxylase carboxyltransferase domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|45368583|ref|NP_990911.1|NC_005793
Sequence length 233
Comment MdcC [Achromobacter denitrificans plasmid pEST4011]
Sequence
MEWKALAEALFGRHHGMEADGDFLHGEPRFDGQPLTVIGTTNHAPIGVELALAQARVVLD
TVAERPGQPILLLIDTQGQQLRRRDELLGINRAMAHLGACIDLARRSGHAVIALVYDQAL
SGGFITSGLIADACYALPEAEIRVMRIPAMSRVTKLPEEMLTALSQSNPVFAPGVGNYIA
MGGVRALWQGDLAAALRSALAQTGTEDRRACDGGERGGRTLAAGIAQRVLDAA
Download sequence
Identical sequences Q6QHN2 Q93L25
WP_011171710.1.44506 gi|45368583|ref|NP_990911.1|NC_005793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]