SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|470184486|ref|YP_007572459.1|NC_020527 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470184486|ref|YP_007572459.1|NC_020527
Domain Number 1 Region: 3-161
Classification Level Classification E-value
Superfamily CheY-like 1.46e-32
Family CheY-related 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|470184486|ref|YP_007572459.1|NC_020527
Sequence length 204
Comment Response regulator [Sinorhizobium meliloti 2011 plasmid pSymA]
Sequence
MGPTVHIVDDDKSFRAAVGRMLAASGFQIESYSSGEELLARLPRGSGCILLDLQMPGLSG
LELQARLADLAPLLPVVFLTGRGDIGITVRAMKAGAHDFLEKPASSAAVLEAVERALQLC
ETRRKEHDRAQALHTLLASLTPRESQVSDQIVRGKRNKQIAFELNTSERTVKAHRHKVME
KLGVRSLAEVVSMAERLGLLEKTT
Download sequence
Identical sequences Q92ZH7
gi|193782620|ref|NP_435754.2| gi|193782620|ref|NP_435754.2|NC_003037 gi|470184486|ref|YP_007572459.1|NC_020527 NP_435754.2.96377 WP_010967489.1.4234 WP_010967489.1.787 266834.SMa0940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]