SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470184837|ref|YP_007572810.1|NC_020527 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470184837|ref|YP_007572810.1|NC_020527
Domain Number 1 Region: 157-344
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 6.93e-62
Family Methylesterase CheB, C-terminal domain 0.0000226
Further Details:      
 
Domain Number 2 Region: 1-108
Classification Level Classification E-value
Superfamily CheY-like 0.0000000819
Family CheY-related 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|470184837|ref|YP_007572810.1|NC_020527
Sequence length 354
Comment Chemotaxis response regulator protein-glutamate methylesterase [Sinorhizobium meliloti 2011 plasmid pSymA]
Sequence
MVRILLATSTVELEDLVKRAIEGDASAELVLIARSGREAVRMTGELLPDIVAVELCPSGD
DSAETVREIMIAAPTPVVMLSHRDGSQLGTISARALEAGALAVIPAPAAHGMQLEQPAIE
KFLSTIKAMSQVKVVRQWRQKVRGDRAAKDQPPTARTPIGIVGIAASTGGPAAIRAILKD
ISADLPVPILIVQHMSNGFIDGVAASLNATVPLTVKVARNGELLKPGTVYLAPDNCQLGV
SGRSRLRVSDDAPVNGFKPSGSYLFGSIARAFKGESLAVVLTGMGDDGTEGLRALRMAGG
KAIAQDEKSSVVFGMPKSAIGAGLVDLVLPLESIAENITAIARGRSEPEGETRT
Download sequence
Identical sequences A0A0E0ULG7 Q92YM4
NP_436095.1.96377 WP_010967816.1.36834 WP_010967816.1.4234 WP_010967816.1.58221 WP_010967816.1.63001 WP_010967816.1.787 WP_010967816.1.90968 WP_010967816.1.94084 gi|16263302|ref|NP_436095.1|NC_003037 gi|384532642|ref|YP_005718246.1|NC_017324 gi|470184837|ref|YP_007572810.1|NC_020527 gi|384532642|ref|YP_005718246.1| gi|16263302|ref|NP_436095.1| 266834.SMa1561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]