SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|470204229|ref|YP_007598328.1|NC_020548 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|470204229|ref|YP_007598328.1|NC_020548
Domain Number 1 Region: 148-332
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 5.23e-59
Family Methylesterase CheB, C-terminal domain 0.0000333
Further Details:      
 
Domain Number 2 Region: 1-105
Classification Level Classification E-value
Superfamily CheY-like 2.56e-22
Family CheY-related 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|470204229|ref|YP_007598328.1|NC_020548
Sequence length 348
Comment chemotaxis-specific methylesterase [Azoarcus sp. KH32C plasmid pAZKH]
Sequence
MKIAIVNDLPMAVEALRRALAGNSGHQVVWTAADGAEAVARCKQETPDLLLMDLVMPGMD
GVEATRRIMDETPCAILIVTSSVGANTWRVFDAMGHGALDAVDTPVLGGDPRTGAASLLA
KIDAIGRLIGGGRPVAMPAVRRQSVGIERLVAIGASAGGPAALSALLSALPGDFPAAVVI
VQHVDRQFAVGMAEWLRQHSRLPVQVAEEGDRPQPGRVLLAGTNDHLAFTSAHRLGYTRE
PVDCVYRPSVDAFFHSVCRFWPGETIGVLLTGMGRDGALGLKALRDRGWHTIAQDRTTSA
VYGMPKAAADVSAAVEILALDRIARRLVERFGRVPQGGARTVAMPPTE
Download sequence
Identical sequences H0Q5K8
WP_015452045.1.10474 gi|470204229|ref|YP_007598328.1|NC_020548 gi|470204229|ref|YP_007598328.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]