SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|482881579|ref|YP_007878761.1|NC_021080 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|482881579|ref|YP_007878761.1|NC_021080
Domain Number 1 Region: 2-138
Classification Level Classification E-value
Superfamily CheY-like 3.42e-31
Family CheY-related 0.00034
Further Details:      
 
Domain Number 2 Region: 148-217
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 4.42e-20
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|482881579|ref|YP_007878761.1|NC_021080
Sequence length 222
Comment putative two-component system response regulator [Rhodococcus fascians D188 plasmid pFiD188]
Sequence
MTIRVLLADDQELVRDGIAAVLRAEPDIVVVGEAANGAEAVDLAVSLRPDVVVMDIRMPV
LDGIRATEQILASLGERTNSIRVLMLTTFDLDDYVYEALSVGASGFLLKQSTAADFVRGV
RTVASGESMLAPTVTTRLISEFARRRRGRPNTAAVSALTPRELDVLDALATGLSNREIAS
DLVLAEETVKTHVGRILTKLDLRDRTQAVVFYYENELSHRLD
Download sequence
Identical sequences A0A259WYZ5 A0A259Y0Q5 A0A260I9M8 A0A260P4C5 A0A260QBT6 G8JYZ9
WP_015586188.1.16409 WP_015586188.1.16635 WP_015586188.1.17547 WP_015586188.1.38359 WP_015586188.1.41042 WP_015586188.1.46264 WP_015586188.1.47693 WP_015586188.1.51077 WP_015586188.1.5156 WP_015586188.1.51752 WP_015586188.1.55785 WP_015586188.1.62393 WP_015586188.1.65029 WP_015586188.1.66552 WP_015586188.1.71068 WP_015586188.1.74102 WP_015586188.1.78957 WP_015586188.1.85845 WP_015586188.1.89189 WP_015586188.1.96656 gi|482881579|ref|YP_007878761.1|NC_021080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]