SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|489596853|ref|WP_003501296.1|NZ_AFSD01000008 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|489596853|ref|WP_003501296.1|NZ_AFSD01000008
Domain Number 1 Region: 1-256
Classification Level Classification E-value
Superfamily ClpP/crotonase 5.58e-77
Family Crotonase-like 0.00000845
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|489596853|ref|WP_003501296.1|NZ_AFSD01000008
Sequence length 256
Comment dihydroxynaphthoic acid synthetase [Agrobacterium tumefaciens F2 plasmid unnamed p2]
Sequence
MDYQDIIYEVREQAAWITINRPEKYNAFRGQTCEELIHAINKAGWDKAIAAIVLTGTGPK
AFCTGGDQSAHDGAYDGRGTIGLPVEELQSLIRDVPKPVIARVNGFAIGGGNVLVTCCDL
AIASSNAVFGQVGPKVGSVDPGFGTALLARVVGEKKAREIWMLCRRYPADQALQMGLINA
VVAPEELDAEVDRWCAEIAALSPTAIAIAKKSFNLDSESIRGISGIGMQALSLFYQTEES
KEGVKAFLEKRPPKFR
Download sequence
Identical sequences F7UHA5
WP_003501296.1.22242 WP_003501296.1.37077 gi|489596853|ref|WP_003501296.1|NZ_AFSD01000008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]