SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|516015901|ref|WP_017446484.1|NZ_AMRX01000008 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|516015901|ref|WP_017446484.1|NZ_AMRX01000008
Domain Number 1 Region: 183-279
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 1.7e-21
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.0072
Further Details:      
 
Domain Number 2 Region: 112-177
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.00000000000000817
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.0017
Further Details:      
 
Domain Number 3 Region: 25-111
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), transmembrane region 0.00000000000785
Family Mechanosensitive channel protein MscS (YggB), transmembrane region 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|516015901|ref|WP_017446484.1|NZ_AMRX01000008
Sequence length 324
Comment hypothetical protein [Gayadomonas joobiniege G7 plasmid pG7]
Sequence
MSFDKLLEQAEEKLLSWWEGVGAMLPNIALAIVVLFIFTVTSGWVEKGFRRLLRRSIKSI
EILNLLLALIKVLYLVLGIFIALDLVGLKGTVASLLAGAGIIGLAIGFAFQDMAENLIAG
IFLGIRKPFKVGHIIKCGDIFGTVKNINLRNTIVESFFGQWLIVPNKTLFRNTVTNYYMT
AERQMEVEVGISYADDPRKAAKVIHEAINKLDFVINKDLTTIFADGFADSSVILKAWFWF
KYPGEPGYLDVRHEAICTIKEVLEENDILIPFPIRTLDFNAKGGQTLSQTELLTRASRQE
DIDSAHQTEKETRSQPSAQENGGE
Download sequence
Identical sequences gi|516015901|ref|WP_017446484.1|NZ_AMRX01000008 WP_017446484.1.28635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]