SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|522818585|ref|YP_008145132.1|NC_021623 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|522818585|ref|YP_008145132.1|NC_021623
Domain Number 1 Region: 12-108
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 1.31e-22
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|522818585|ref|YP_008145132.1|NC_021623
Sequence length 115
Comment cellobiose-specific IIA component [Borrelia hermsii plasmid lp174]
Sequence
MKNKEYTTEELIDNVSMPVVAYAGEAKSFLREALGAAKAGDYEKSQEMMEMSRSSLAKAY
DAHKDVVQYSVTNPEFIKIPFILIHAEDHLMSAVSDLSIFEELITVYKVINELKK
Download sequence
Identical sequences T1ECC5
gi|522818585|ref|YP_008145132.1|NC_021623 WP_020732436.1.33311 WP_020732436.1.52594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]