SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|525712331|ref|YP_008238595.1|NC_021745 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|525712331|ref|YP_008238595.1|NC_021745
Domain Number 1 Region: 183-371
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.22e-72
Family Methylesterase CheB, C-terminal domain 0.000000287
Further Details:      
 
Domain Number 2 Region: 6-111
Classification Level Classification E-value
Superfamily CheY-like 4.98e-27
Family CheY-related 0.0000091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|525712331|ref|YP_008238595.1|NC_021745
Sequence length 379
Comment Chemotaxis response regulator protein-glutamate methylesterase CheB [Ralstonia solanacearum FQY_4 plasmid megaplasmid]
Sequence
MNEKRKIQVLCIDDSALIRSILKEIINAQPDMEVVGVAPDPIIARDLIKQTNPDVLTLDV
EMPKMDGLDFLEKLMRLRPTPVVMISSLTERGSEATLRALELGAVDFVAKPKLGMRDGMN
EYADQIADKIRAAARARLRPRTASPAPAAASPAHVVHTAHAVHARPEHDAAAVPAPARTH
FSSTEKLIIVGASTGGTEAIKDFLLEMPPDCPGILIVQHMPAGFTTSFAKRLDGLCRIRV
KEAVHGERVLPGHAYIAPGDMHLSLGRSGANYVTELDQNPPVNRHRPAVDVLFRSAARNA
GANALGVILTGMGKDGAAGMLEMRNAGAYNVAQDEASCVVYGMPKEAVAHGGVHEILPLH
QIGPHVLARLSAHGRVTRV
Download sequence
Identical sequences A0A0K1ZTM1 A0A1L3DLU4 M4V428
gi|518549731|ref|WP_019719938.1|NZ_CM002756 gi|518549731|ref|WP_019719938.1|NZ_CM002758 gi|525712331|ref|YP_008238595.1|NC_021745 WP_019719938.1.10616 WP_019719938.1.13792 WP_019719938.1.19504 WP_019719938.1.25797 WP_019719938.1.32568 WP_019719938.1.37141 WP_019719938.1.39277 WP_019719938.1.57025 WP_019719938.1.57909 WP_019719938.1.58753 WP_019719938.1.65509 WP_019719938.1.65551 WP_019719938.1.67163 WP_019719938.1.67756 WP_019719938.1.67790 WP_019719938.1.72398 WP_019719938.1.76782 WP_019719938.1.80635 WP_019719938.1.87978 gi|525712331|ref|YP_008238595.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]