SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|528837602|ref|YP_008368682.1|NC_021911 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|528837602|ref|YP_008368682.1|NC_021911
Domain Number 1 Region: 6-190
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.12e-48
Family Methylesterase CheB, C-terminal domain 0.0000929
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|528837602|ref|YP_008368682.1|NC_021911
Sequence length 340
Comment chemotaxis protein-glutamate methylesterase CheB-type protein [Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1f]
Sequence
MSSSATKDIIAIGGSAGSGTVLKTLVADLPADLPASVFVSTHIPANSPGHLPEILSARSK
LPVTQAIDGQPIERGHIYLAAPDRHLLLMGETIKFGAGPRENMVRPSIDPMFRSAALSFG
PRVVGLVLSGMLNDGAAGLHAIKSNGGTTVVQHPLDAEADQMPLAALEAVEVDHVAPAAD
LGKLLAGIAGSDAGPARGPPSAGLRLEVEIAAGARLGSAELRKIASPTALTCPDCHGVLS
EVRGSQPLRFRCQIGHAYTADALVAHIDELDAAIRIAMRVMEERLTLVERMARDARDTGR
TAVAELYEARAVEYKQYSETLRQAALTSLRLGHASRFQDS
Download sequence
Identical sequences S5S6T1
gi|528837602|ref|YP_008368682.1|NC_021911 gi|528837602|ref|YP_008368682.1| WP_020919129.1.76939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]