SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|528837603|ref|YP_008368683.1|NC_021911 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|528837603|ref|YP_008368683.1|NC_021911
Domain Number 1 Region: 293-486
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 4.55e-48
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00028
Further Details:      
 
Domain Number 2 Region: 24-202
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 8.37e-27
Family Methylesterase CheB, C-terminal domain 0.00049
Further Details:      
 
Domain Number 3 Region: 970-1102
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.98e-21
Family Heme-binding PAS domain 0.015
Further Details:      
 
Domain Number 4 Region: 846-953
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.89e-18
Family Heme-binding PAS domain 0.02
Further Details:      
 
Domain Number 5 Region: 228-295
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.00000000000471
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0098
Further Details:      
 
Domain Number 6 Region: 728-848
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000147
Family Heme-binding PAS domain 0.038
Further Details:      
 
Weak hits

Sequence:  gi|528837603|ref|YP_008368683.1|NC_021911
Domain Number - Region: 658-746
Classification Level Classification E-value
Superfamily Tropomyosin 0.00126
Family Tropomyosin 0.0041
Further Details:      
 
Domain Number - Region: 1177-1291
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.0247
Family Histidine kinase 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|528837603|ref|YP_008368683.1|NC_021911
Sequence length 1324
Comment chemotaxis protein-glutamate methyltransferase CheR-type protein [Rhizobium etli bv. mimosae str. Mim1 plasmid pRetMIM1f]
Sequence
MMAYDEQQSMEQQASAPDQGRHEQPVVIVGIAVCAQSVSSLEQIFSQIDVDLGASYLVAV
RQEGVDAAAVLDMLGRQDRLAVTVAVDGERILPNHVYIAGSDDMMTLEDGHIRIRPASEP
IGHRGTIDTMLISLAEHAQERAIAVVLRGLESDGTAGVAATKKFGGLSIVETGEGTDGSS
EEGGGALAIADLRLPAQGIATHISLYAGNVTEEEDAGLDDEPPSALEAQITQIATILRNV
TSHDFHGYKRGTFTRRVQRRMQVLQIASIEAYIERLRASRDEVQNLFQDLLIGVTQFFRD
PAEFEALEREIPRLFEGKEPGDQLRVWVLGCATGEEAYSIAMLLREHMATMDYPPDVQIF
ATDLDARALGIARGGRYSAAITSQVPPERLARWFVREGDTYCVVKELREMCIFSPHNIVK
DAPFSRIDILSCRNLLIYLDSELQNRVIPIFHFALRPSGILFLGSSENVTRHTKLFAPVD
RKNRLFRRLETATRIIPDFPLSPRPRSPDHPLSAPAPMLQTGRLSATISRQAEVVAERFA
PAYVVVDSHYDVLHFSGRTGRYLEPASGTATLNLLSLAHRDLRLDMRSALQRATTEAIKV
EVPRVLLRQDDRTYAVNIIVEPLGSGDVTSLIVLFQDAGQVAEGTAPDGGRLTSEEHVQR
LETDLRVTRDRLQATIEELESTNEELKSSNEEYQSINEELQSANEEMETSKEELQSVNEE
LQTVNGELAHRVTELDRTNSDLKNLLEATQIATVFLDNDLRVRSFTPAATEIFHLLDTDV
GRPLDHVVSRVAYPELLDDVRLVLRTLVPTDRKVSDPTNNRHYAARALPYRSVDNYISGA
VVTFTDLTATYEAEVALRRSEERLQRVLETDAVGVIFLNQDGVIFDANEVFLKMSGYTRS
QMERGELHWRRLTPEEHHAESEAQMEALKETGKIGPYEKEYFLADGTRRWMLFAGRDLGD
GTVAEFCIDISARKQAQAALRQGEEQFRLFGEASSDVLWIRDAETLQWVYLTPAFETIYG
VDREQAMTGNNFRSWAELIIPEDREQALSEIGRVREGERVEFEYRIRRASDHEIRWLRNA
DFPLFGEEGNVKQIGGIGRDITEEKASAERMKVLVAELQHRTRNLMAVVRSMAEKTMRTS
TDLADFHERFRDRLDVLARVQGLLSRLQEGDRITFDQLIRSELAAHGMLEGENSRISLQG
PDGVRLRSTTVQTMALAMHELGTNAVKYGALSQARAHLAITWRVEQSGEGGKPWLHVDWQ
ESGVKMPAADSGPQGGGQGRELIERALPYQLDAKTSYVLGEDGVHCTIAIPVSLSNLIEA
EAYG
Download sequence
Identical sequences S5SW37
gi|528837603|ref|YP_008368683.1|NC_021911 gi|528837603|ref|YP_008368683.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]