SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|530320721|ref|YP_008406682.1|NC_022043 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|530320721|ref|YP_008406682.1|NC_022043
Domain Number 1 Region: 3-204
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.49e-53
Family Crotonase-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|530320721|ref|YP_008406682.1|NC_022043
Sequence length 205
Comment enoyl-CoA hydratase [Paracoccus aminophilus JCM 7686 plasmid pAMI5]
Sequence
MILREFTEGLGIVTLARTHKANSLTEDMLRQLCDVFDEAAARPDLRALILTGEGKVFSAG
ADLEEAKAGLALSPEWERLSSRVAALPCLTIAALNGTLAGGAFGMALACDIRLAVPEARF
FYPVMRLGYLPQPSDPGRLAALVGPGRTKMVLMAGQKISAQEALVWGLVDRLVAPEDLMA
EAKALTADVLTAKAAHVAGIKQMIS
Download sequence
Identical sequences S5Y6T9
WP_020953071.1.73483 gi|530320721|ref|YP_008406682.1| gi|530320721|ref|YP_008406682.1|NC_022043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]