SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|549717273|ref|YP_008640883.1|NC_022542 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|549717273|ref|YP_008640883.1|NC_022542
Domain Number - Region: 21-64
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 0.0824
Family Methylesterase CheB, C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|549717273|ref|YP_008640883.1|NC_022542
Sequence length 135
Comment hypothetical protein XFF4834R_plc00080 [Xanthomonas fuscans subsp. fuscans plasmid plc]
Sequence
MSTATAQRFDWKEAAKVGGVVIGFMAVTGGLAAITQLSTHIVKTTPAGVVQTVTVDPGSE
GSFGGIGTTGRGIALVTGSTSSSPRSVITTDTGRFVVNGVAPMLAGDRVDLRTGATGRRY
VCPATNYHDCYRTVD
Download sequence
Identical sequences A0A2D2ULE2 A0A2H1PDR2 U4M431
WP_022560513.1.100431 WP_022560513.1.22114 WP_022560513.1.25999 WP_022560513.1.31364 WP_022560513.1.34035 WP_022560513.1.37259 WP_022560513.1.40308 WP_022560513.1.42602 WP_022560513.1.43567 WP_022560513.1.45197 WP_022560513.1.49137 WP_022560513.1.52218 WP_022560513.1.56360 WP_022560513.1.62152 WP_022560513.1.6771 WP_022560513.1.71353 WP_022560513.1.72777 WP_022560513.1.74121 WP_022560513.1.91667 WP_022560513.1.93402 WP_022560513.1.96800 WP_022560513.1.98824 gi|549717273|ref|YP_008640883.1|NC_022542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]