SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568288000|ref|YP_008973984.1|NC_023136 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568288000|ref|YP_008973984.1|NC_023136
Domain Number 1 Region: 129-311
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 6.8e-58
Family Methylesterase CheB, C-terminal domain 0.0000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|568288000|ref|YP_008973984.1|NC_023136
Sequence length 314
Comment chemotaxis protein [Leisingera methylohalidivorans DSM 14336 plasmid unnamed2]
Sequence
METAYPGMKVLLANNLMMAYNQAEAAQPAFAFVEDGFSKLPEFEMMMALFSAMDTRWVAV
MDSQAATPARKSSPLLDVGAGIFELTKADHPSQFAQYFDMMINAPRRSARAAPGIAGARP
SAAAAASKKLILIGSSTGGVEALRSILVGFPFDCPPTLIVQHTGRNFGSGLVSLLDRLCP
ARVRAAEDGTALEPGHVYVAAGQRRHMGLSSRKPLRLRMKDGPDISGHTPSVDALFTSAV
PYGKDVVATILTGMGHDGAQGLLELRKAGAKTFAQDEKSSVVYGMPRVAWDIGAAQQQVP
LPRMASTLLQASKA
Download sequence
Identical sequences V9W2A5
gi|568288000|ref|YP_008973984.1| gi|568288000|ref|YP_008973984.1|NC_023136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]