SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|568305594|ref|YP_008977878.1|NC_023138 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|568305594|ref|YP_008977878.1|NC_023138
Domain Number 1 Region: 149-332
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.83e-55
Family Methylesterase CheB, C-terminal domain 0.0000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|568305594|ref|YP_008977878.1|NC_023138
Sequence length 334
Comment Chemotaxis response regulator [Phaeobacter gallaeciensis DSM 26640 plasmid pGal_A255]
Sequence
MSQSLLIITTDRRFAQTLQQHMEATYPGLQVLLANNLMMAYNQAEAGQPTFAFVEDGFTK
LPEFEMMLALFSALDIRWVSVMDNQGSTPARNSSPLLDVGAGIFELTKSDNPRDFSRYFD
MMVKAPRRDQASPLQKQTAGAAAGQGSDKIILIGSSTGGVEALRSVLVGFPLNCPPTLIV
QHTGKNFGRGLVSLLDRICPAKVLAADDNMTLSPGHVYVAAGQPRHMGMTPRKPYRTRFK
EGPPISGHMPSVDALFMSAVPIAKSVVATILTGMGQDGAQGLLELRKAGAKTFAQDEKSS
VVYGMPRVAWEMGAAQQQVSLARMAGTLIQACKT
Download sequence
Identical sequences V9WNB1
gi|568305594|ref|YP_008977878.1|NC_023138 WP_024099220.1.25178 WP_024099220.1.95089 gi|568305594|ref|YP_008977878.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]