SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|67459870|ref|YP_247492.1|NC_007111 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|67459870|ref|YP_247492.1|NC_007111
Domain Number 1 Region: 2-72
Classification Level Classification E-value
Superfamily CheY-like 0.0000000000000142
Family CheY-related 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|67459870|ref|YP_247492.1|NC_007111
Sequence length 76
Comment hypothetical protein RF_pd08 [Rickettsia felis URRWXCal2 plasmid pRFdelta]
Sequence
MAHIAKYKIDVIILGIDLEEVDGIKICTRLKQNPSTTYIPVVMIAEKEDTDIRIQAFNAG
ADELITYPINIIVFTS
Download sequence
Identical sequences Q4UJD0
gi|67459801|ref|YP_247424.1| gi|67459870|ref|YP_247492.1| WP_011271705.1.40963 gi|67459801|ref|YP_247424.1|NC_007110 gi|67459870|ref|YP_247492.1|NC_007111 315456.RF_p08 315456.RF_pd08

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]