SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|86360808|ref|YP_472695.1|NC_007766 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|86360808|ref|YP_472695.1|NC_007766
Domain Number 1 Region: 6-190
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 5.1e-48
Family Methylesterase CheB, C-terminal domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|86360808|ref|YP_472695.1|NC_007766
Sequence length 340
Comment protein-glutamate methylesterase [Rhizobium etli CFN 42 plasmid p42f]
Sequence
MSSSATKDIIAIGGSAGSGVVLKTLVADLPADLPASVFVSTHIPANSPGYLPEILSARSK
LPVTQAIDGQLIERGHIYLAAPDRHLLLMGETIKFGAGPRENMVRPSIDPMFRSAALSFG
PRVVGLVLSGMLNDGAAGLHAIKSNGGTTAVQHPLDAEADQMPLAALEAVEVDHVAPAAD
LGKLLAGIAGSDAGPARGPPSAGLRLEVEIAAGARLGSAELRKIASPTALTCPDCHGVLS
EVRGSQPLRFRCQIGHAYTADALVAHIDELDAAIRIAMRVMEERLTLVERMARDARDTGR
TAVAELYEARAVEYKQYSETLRQAALTSLRLGRASRFQDS
Download sequence
Identical sequences Q2JZL8
gi|86360808|ref|YP_472695.1|NC_007766 347834.RHE_PF00075 WP_011428385.1.62937 gi|86360808|ref|YP_472695.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]