SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|90962769|ref|YP_536684.1|NC_007930 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|90962769|ref|YP_536684.1|NC_007930
Domain Number 1 Region: 200-362
Classification Level Classification E-value
Superfamily DNA breaking-rejoining enzymes 1.32e-34
Family Lambda integrase-like, catalytic core 0.0008
Further Details:      
 
Weak hits

Sequence:  gi|90962769|ref|YP_536684.1|NC_007930
Domain Number - Region: 10-91
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 0.00824
Family Methylesterase CheB, C-terminal domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|90962769|ref|YP_536684.1|NC_007930
Sequence length 365
Comment site-specific tyrosine recombinase XerS [Lactobacillus salivarius UCC118 plasmid pMP118]
Sequence
MQKEVANKKIDELLHELPYYMNDFVIVKTADEYSPNTILEYLKNFHQFLIWLIENHYVNE
NKTSDIAPESLDKLTVRTATEYKSYLLRRKKQNKKALDKNGHKEESTETLSKVTIQRNIT
ALKVIFKFLSRSANNSQEKPFLTHDVMQSIDNVADKQTLQARADALEEKLFLDDETDEYL
QYIKEVYPQSLSTQAKKFYNRDVERDLAINALMLGSGLRLSEVVNINIEDLDFENNRVAV
LRKGNKKDSVRIAAFAMEYLANYRDIRASRYRADKYEKAFFLAISRGGSKRITGSAIEKM
VSKYSKGFKVRVTPHKLRHTLATRLYKQTNNLVLTAQQLGHSSTATTTLYTHIDNDETTD
ALNSL
Download sequence
Identical sequences A0A089QKN0 A0A0F7PW93 A0A2A7QP71 A0A2A7RA21 F5VG36 F7QWY8 Q1WR97 V6DL35
WP_003703247.1.14256 WP_003703247.1.15614 WP_003703247.1.17280 WP_003703247.1.18154 WP_003703247.1.18878 WP_003703247.1.2488 WP_003703247.1.34351 WP_003703247.1.4481 WP_003703247.1.61399 WP_003703247.1.62422 WP_003703247.1.63458 WP_003703247.1.65019 WP_003703247.1.65843 WP_003703247.1.76244 WP_003703247.1.76636 WP_003703247.1.7912 WP_003703247.1.81444 WP_003703247.1.86350 WP_003703247.1.90376 WP_003703247.1.90868 YP_536684.1.8253 gi|90962769|ref|YP_536684.1| gi|90962769|ref|YP_536684.1|NC_007930 362948.LSL_1797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]