SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|92109717|ref|YP_572003.1|NC_007961 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|92109717|ref|YP_572003.1|NC_007961
Domain Number 1 Region: 31-210
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 5.49e-51
Family Methylesterase CheB, C-terminal domain 0.00012
Further Details:      
 
Domain Number 2 Region: 301-492
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 5.92e-47
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00086
Further Details:      
 
Domain Number 3 Region: 237-303
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0000000000196
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.01
Further Details:      
 
Domain Number 4 Region: 758-863
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000314
Family Heme-binding PAS domain 0.043
Further Details:      
 
Weak hits

Sequence:  gi|92109717|ref|YP_572003.1|NC_007961
Domain Number - Region: 666-750
Classification Level Classification E-value
Superfamily Tropomyosin 0.000163
Family Tropomyosin 0.0075
Further Details:      
 
Domain Number - Region: 933-1054
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.00241
Family Histidine kinase 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|92109717|ref|YP_572003.1|NC_007961
Sequence length 1092
Comment MCP methyltransferase, CheR-type [Nitrobacter hamburgensis X14 plasmid 3]
Sequence
MLPQELHGEKVEGKQPTPDQSGVIATKRRPPSLVVGIGASAGGLDAFKSFFEGVPADTGM
SFVLVQHLDPNHKSLLVELLRPHTSMRVEEARDGVALAANHIFVIPPNATMTMEGDLLRV
STPAPAREYRRPIDTFFTSLAENQQECAVAVVLSGVGSDGTLGVKAIKENGGYTFAQAEF
NETAMSGMPRSAVATGLVDCVAPVKNLPAKRLEHQAHLTKVEEQKDSEGVRDDVRESLTT
ITSLLRKRLKHDFSGYKQNTIIRRVQRRMQVLQIEAVPAYVERLRREPPEADALFRELLI
GVTQFFRDESAFEALKTAILPSLLAAKQPDDTIRVWVAGCATGEEVYSIAIVLKEAMAEL
NVEPSVTIFGTDIDGKAVAFARAARYRKTDGVSPERLGRWFVREREHYCPVATIREMCVF
SQHSIIKDPPFSKLDLVSCRNVLIYMDNEFQHRVMQTFHYGLNPGGYLFLGPSESVSREI
KLFTIIDKKHRILQRQDGVRATLPVVQTASSLRAVEPTWSAEVHAEDGIDQSARRAMDKY
APAYFVIDRHCEVLRFSGAETGRYLEPSPGTATLNLFGILAKALRSQVRNAVDTSFATHQ
TVVDETVAATIDGRWYSVQLIVEPIVEIARSPAFFIVAFRERGPLTNGGEAGKTAPAVSD
LDAASHQQELRSWQARYKAASNELETHIENMKSVTEEYQSVNEELQSSNEELETAKEEMQ
SVNEELQTVNSEMQSKNDQLNGVNNDLQNLLDSTQIATIFLDDNLHIKNFTPAAMELFAL
HDCDRGRAITDIVTLLAYDKLREDVRKVQRTLAVVEQELDLKDESATFIMRIRPYRTVKN
VITGVVITFTDITERKAQDDQLRVLMKELQHRTNNLFRVIQAMARQTAKHSANFADFEVQ
FGARIQGLSESNTLLIGQNWQSVSLERLVRTQLAPFIGTDQARLEIDGLAVFVATEAVQT
LGLALHELATNASKYGALSVPGGRILLQWKFTGGDKIPEGFRLEWRERGGPTVKPAKRRG
FGRFVIDQMVTSSLHATVGIDLAPEGFRWTLDMPASQVQRAMPDKEGMKNGESGSAPLFD
VGIKKPEQSDYL
Download sequence
Identical sequences Q1QF26
323097.Nham_4605 gi|92109717|ref|YP_572003.1| WP_011505251.1.12189 gi|92109717|ref|YP_572003.1|NC_007961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]