SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94312625|ref|YP_585834.1|NC_007974 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94312625|ref|YP_585834.1|NC_007974
Domain Number 1 Region: 161-347
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 9.42e-72
Family Methylesterase CheB, C-terminal domain 0.000000231
Further Details:      
 
Domain Number 2 Region: 5-110
Classification Level Classification E-value
Superfamily CheY-like 4.41e-28
Family CheY-related 0.00000596
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|94312625|ref|YP_585834.1|NC_007974
Sequence length 357
Comment chemotaxis protein CheB [Cupriavidus metallidurans CH34 plasmid megaplasmid]
Sequence
MTAAKIKVLCVDDSALIRSLMSEIINSQPDMEVVGTAPDPLVARDLIKRVNPDVLTLDVE
MPRMDGLDFLERLMRLRPMPVLMVSSLTERGSEITMRALELGAVDFVTKPKLGIREGLLD
YTQTIADKIRAASRARVRARAEQSAGAAPVAPMLRAPLLSTEKLIIVGASTGGTEAIKDF
LTPLPPDSPAVMIVQHMPAGFTKSFAHRLNGLCRITVKEAEHGERVLPGYAYIAPGDSHL
LLARSGANYVAHLSQEAPVNRHRPSVDVLFDSAAIHGGKNVTGVILTGMGKDGARGMLRM
REAGAYNLAQDEQSCIVFGMPKEAIAAGGVHEVVPLHQMSQRVMAHLATFGARAQRV
Download sequence
Identical sequences A0A132HFX2 Q1LH11
gi|94312625|ref|YP_585834.1| gi|94312625|ref|YP_585834.1|NC_007974 WP_011518214.1.12480 WP_011518214.1.22474 WP_011518214.1.25839 WP_011518214.1.38154 WP_011518214.1.481 WP_011518214.1.52493 WP_011518214.1.66126 266264.Rmet_3693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]