SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|94312896|ref|YP_586105.1|NC_007974 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|94312896|ref|YP_586105.1|NC_007974
Domain Number 1 Region: 148-333
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 5.36e-62
Family Methylesterase CheB, C-terminal domain 0.0000226
Further Details:      
 
Domain Number 2 Region: 1-104
Classification Level Classification E-value
Superfamily CheY-like 1.08e-19
Family CheY-related 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|94312896|ref|YP_586105.1|NC_007974
Sequence length 338
Comment chemotaxis-specific methylesterase [Cupriavidus metallidurans CH34 plasmid megaplasmid]
Sequence
MRIGIVNDSALAVAALRRALALDTTLEIAWIAGDGEEAVRMAATQTPDLILMDLLMPVMD
GVEATRRIMAESPCAIVVVTMDLGRNANQVFDAMGHGAIDAVDTPTLTDSDTKLAAGPLL
RKIRNIARLLGGRGQAPHPLAAATPTPTAPRLVAIGASAGGPAALATLLGALPADFGAAV
VAVQHVDEAFAQGMAEWLDAQCQLPVRLARAGEVPQAGAVVLAGTNDHLRLTSAGRLIYT
PDPCDYLYRPSIDVFFESVVEHWRGEAIGVLLTGMGRDGAQGLKAMRERGFQTIAQDQAT
SAVYGMPKAAATLGAASEILPLQKIAPRLVMTCGGGRR
Download sequence
Identical sequences Q1LG90
WP_011518475.1.12480 WP_011518475.1.25839 gi|94312896|ref|YP_586105.1|NC_007974 266264.Rmet_3968 gi|94312896|ref|YP_586105.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]