SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|99078188|ref|YP_611446.1|NC_008043 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|99078188|ref|YP_611446.1|NC_008043
Domain Number 1 Region: 123-308
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.44e-55
Family Methylesterase CheB, C-terminal domain 0.0000151
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|99078188|ref|YP_611446.1|NC_008043
Sequence length 311
Comment CheB methylesterase [Ruegeria sp. TM1040 plasmid mega plasmid]
Sequence
MEAAYPGLQVLLANNLMMAYNQAEAGQPSFAFVEDGFTKLPEFEMMLALFSALDVRWVSV
MDDQNSTPARRSSPLLNVGAGIFELTKSDSPRQFIQYFDMMIKAPRRNAPRAAANKPPVG
RDDFKKVILIGSSTGGVEALRNVLVGFPINCPPTLIVQHTGKSFGTGLVSLLDRICPAKV
VAADDNITLQSGHVYIAAGQPRHMGVTPRKPFKIRMKEGPNISGHTPSVDALFSSAVPFA
RDVVAAILTGMGQDGAKGMLDLRKAGATTFAQDEKTAVVYGMPRVAWEIGAAQKQVPLAR
MANAILQASKT
Download sequence
Identical sequences Q1GMD2
WP_011536828.1.15988 292414.TM1040_3210 gi|99078188|ref|YP_611446.1| gi|99078188|ref|YP_611446.1|NC_008043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]