SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|111025248|ref|YP_707668.1|NC_008269 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|111025248|ref|YP_707668.1|NC_008269
Domain Number 1 Region: 44-492
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.06e-73
Family Glycine dehydrogenase subunits (GDC-P) 0.00000157
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|111025248|ref|YP_707668.1|NC_008269
Sequence length 518
Comment glycine dehydrogenase subunit 2 [Rhodococcus jostii RHA1 plasmid pRHL1]
Sequence
MSTRVNEIQAPVWNEPIIMEMGYPGRRGAVFSHAEDGIEARVGAAVDLIPTAVRRGDRPA
LPEMSEPEVLYHYLRLSQQTLGMMGVSLFGTCTMKYNPQVNEALAWRPEVTEVHPLQHED
TLQGTLEIVHGMDLILRELSGMDQFVFQAGGGAEAAFVNASVTRAYHASRGELEQRNEVI
TTIQTHPCNAATAAAAGFKVITLMLDENGYPSLDALKAAVSNRTAALMVGNPDDMGVYNP
EMKEWVEIVHEAGGLCFYDSANFNGTMSKIRPREIGFDACMFMLHKTFGAPKSGVGGPAT
GAYGCSAELAPFLPAPLVTFDGERYHLDHDRPDSVGKIREFWGNVPVILKAYAWVRAMGA
EGIAQASDISVLGNNYMEKGLLAIRGVTRSHPESTSPRLEMTRYSMQILKEDTGVDVHDV
QNRMTDFGIDAMWTSHEPWLIPEPFTPEAGEMYGKESLDQWIAVLAQISDEAYSNPDIVK
SAPHNQAIHRLKPGVTDDPSTRAMTWRAFQRSRAQSRS
Download sequence
Identical sequences I0WXW0 Q0RYX6
101510.RHA1_ro08466 gi|111025248|ref|YP_707668.1|NC_008269 gi|111025248|ref|YP_707668.1| WP_007296139.1.59368 WP_007296139.1.78234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]