SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|111027123|ref|YP_709101.1|NC_008271 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|111027123|ref|YP_709101.1|NC_008271
Domain Number - Region: 74-115
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.017
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|111027123|ref|YP_709101.1|NC_008271
Sequence length 237
Comment hypothetical protein RHA1_ro11296 [Rhodococcus jostii RHA1 plasmid pRHL3]
Sequence
MKKTTLGRSTPRHPAVLDLLGSPSTIDHPPGARTMAPGGPATPLPPPRSPLPSPRGRRLG
KNAVADIAAVAVVVAGGVAISHLRSGDSETASPAATTTPTATVAVDENGLPILNLPEPEQ
TENASASDGDCRADRGDQTSGAGVIAAFNHAYYSLRNGEAARGLATSTSSVLPGPELQKV
IDAVPIGTNYCLRTAELADGVYLVDLSVMQPAQPAKRGTQTVTTQEVDGKWYVDVFN
Download sequence
Identical sequences Q0RUU3
WP_011600568.1.78234 gi|111027123|ref|YP_709101.1| gi|111027123|ref|YP_709101.1|NC_008271 101510.RHA1_ro11296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]