SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|146275739|ref|YP_001165899.1|NC_009427 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146275739|ref|YP_001165899.1|NC_009427
Domain Number 1 Region: 69-336
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.54e-63
Family L-arabinose binding protein-like 0.0000543
Further Details:      
 
Domain Number 2 Region: 8-65
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 1.03e-17
Family GalR/LacI-like bacterial regulator 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|146275739|ref|YP_001165899.1|NC_009427
Sequence length 338
Comment LacI family transcription regulator [Novosphingobium aromaticivorans DSM 12444 plasmid pNL2]
Sequence
MKKAKDGKPTINDVARIAGVSKKTVSRVINRSPLLNEATREKVEAVIAELGYVPNPQARA
LALRRNFLIGLIHDNPNAQMVLGVQEGILSAIRDTEFALVVRPVNRRSPDMLDDVRAFLE
QQRLFGVMLLPPISENDALADLCEDLGVTYVRMGSVRLDDDEHMVASNDREAVARAVAYL
VDHGHRRIGFVAGPDGFRSAAERASGYVDALETAGIKQDATIMAEGNYTFETGIAAGEKL
LAASPRPTAIFASNDEMAAGVLHAARKKGLSVPEDLSIVGFDDTAIAAHIWPPLTTVRWP
IQAMAKAAAIKLIDPAEARRQPSHFLSDLIERASVGTA
Download sequence
Identical sequences A4XEL2
gi|146275739|ref|YP_001165899.1|NC_009427 WP_011906760.1.26809 WP_011906760.1.96002 gi|146275739|ref|YP_001165899.1| 279238.Saro_3513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]