SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146276053|ref|YP_001166213.1|NC_009427 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146276053|ref|YP_001166213.1|NC_009427
Domain Number 1 Region: 120-376
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.7e-61
Family D-glucarate dehydratase-like 0.000000442
Further Details:      
 
Domain Number 2 Region: 9-133
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.92e-34
Family Enolase N-terminal domain-like 0.0000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|146276053|ref|YP_001166213.1|NC_009427
Sequence length 387
Comment muconate and chloromuconate cycloisomerase [Novosphingobium aromaticivorans DSM 12444 plasmid pNL2]
Sequence
MTALANPQILGIETILLDLPTIRPHVLAMATMHAQTICLVRLTCSDGIVGLGEATTIGGL
AYGPEAPETIKTAIDTYFAPLLAGQDATRPAAAMALVARHVVGNHFAKCAIETALLDAQG
KRLGLPVSELLGGRRVDSLPVLWTLASGDTARDIAEAEQMLDTRRHDAFKLKIGKRPIEQ
DVAHVGAIKAALGDRASVRVDVNMAWDEPTARRGLAMLADAGCDLVEQPIIRHNRDGMAR
LVALGLVPVMADESLTGPASAMDFARAAAADVFAVKIEQSGGLDAARAVAQIGDAACIGL
YGGTMLEGAIGTIASAHAFATFPALKWGTELFGPLLLTEEILERPLTYADFSLEVPAGPG
LGIALDEDRVEHFRRDRTATQFALQGA
Download sequence
Identical sequences A4XFH6
gi|146276053|ref|YP_001166213.1|NC_009427 NYSGXRC-9450c gi|146276053|ref|YP_001166213.1| 279238.Saro_3828 WP_011907066.1.26809 WP_011907066.1.96002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]