SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|150375901|ref|YP_001312497.1|NC_009620 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150375901|ref|YP_001312497.1|NC_009620
Domain Number 1 Region: 67-333
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.01e-46
Family L-arabinose binding protein-like 0.00033
Further Details:      
 
Domain Number 2 Region: 7-64
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000000000338
Family GalR/LacI-like bacterial regulator 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150375901|ref|YP_001312497.1|NC_009620
Sequence length 335
Comment periplasmic binding protein/LacI transcriptional regulator [Sinorhizobium medicae WSM419 plasmid pSMED01]
Sequence
MPQKPFVSAQEVAERAGVSRSAVSRTFTPGASVSPETRRRVVEAAEALGYHVNHLARGLM
RNESGIVCLIVSEMSTPYRANLIRAMTQQLQNAGKIAMLINTDRSDGSVDLALRQAIRYR
ADASIILSGMPDRSITQLCLKNGQRLVLINRDDDQQGPLRINLDDAEAAGRVVTAFVRAG
CRRLAFANSQAGTPSLMAREHGFVAAAKTMGLPVRVERHGPTDYESGRVLAQRLLTLSER
PDAVFCATDLLACGFMDAARHQFRVAIPDQLCVVGFDDIEQAAWSSYDLTTFAQPVEMIA
REAVAWLVNESGQAAGDDSVRFQPNLVWRSSVRGG
Download sequence
Identical sequences A6UFY4
gi|150375901|ref|YP_001312497.1|NC_009620 WP_011969387.1.29075 WP_011969387.1.31871 WP_011969387.1.61285 WP_011969387.1.7720 WP_011969387.1.89664 YP_001312497.1.44884 gi|150375901|ref|YP_001312497.1| 366394.Smed_3751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]