SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150376280|ref|YP_001312876.1|NC_009620 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150376280|ref|YP_001312876.1|NC_009620
Domain Number 1 Region: 16-166
Classification Level Classification E-value
Superfamily Regulatory protein AraC 4.58e-16
Family Regulatory protein AraC 0.0061
Further Details:      
 
Domain Number 2 Region: 237-286
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000152
Family AraC type transcriptional activator 0.02
Further Details:      
 
Domain Number 3 Region: 184-234
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000986
Family AraC type transcriptional activator 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150376280|ref|YP_001312876.1|NC_009620
Sequence length 311
Comment AraC family transcriptional regulator [Sinorhizobium medicae WSM419 plasmid pSMED01]
Sequence
MGNSVLRHLMDRGPAMRTVSLPRGRQSLHTMPTSTGYEIRTDASYDWDGRKRGQTPFTVL
QHTIGGAGNLRYESRSFRVSPGETLLLLVPHNHRYWLEDGGRWEFFWISMNGEEALRIHR
AILAVTGPVLKLQPETIEHLADCSLRLITGGETPGSASAIAYEAAMALYDDVFGSHPVLS
DEYRKMQHVIDHILSNLDKPLPVEELAGISGLSRAHFSRVFAASEGMPPAEFVLQKRLQR
AVKLLTKTADLPVKEVAILSGFEDPNYFAKVFRRVFGASPTEFRTTGMYASVPATGRPGG
VDASVSKLARG
Download sequence
Identical sequences A6UH13
366394.Smed_4138 WP_011969765.1.29075 WP_011969765.1.31871 WP_011969765.1.61285 WP_011969765.1.7720 YP_001312876.1.44884 gi|150376280|ref|YP_001312876.1|NC_009620 gi|150376280|ref|YP_001312876.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]