SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150376351|ref|YP_001312947.1|NC_009620 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150376351|ref|YP_001312947.1|NC_009620
Domain Number 1 Region: 7-204
Classification Level Classification E-value
Superfamily Aromatic compound dioxygenase 6.41e-60
Family Aromatic compound dioxygenase 0.00000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|150376351|ref|YP_001312947.1|NC_009620
Sequence length 204
Comment protocatechuate 3,4-dioxygenase subunit alpha [Sinorhizobium medicae WSM419 plasmid pSMED01]
Sequence
MAQDLGYLKETASQTAGPYVHIGLTPNFCGIGGVYEADLGASMVNDRTLGQRITVTGRVI
DGAGMPLKDALLEIWQADAAGLYNSPSERRGAADPNFAGWGRSPTGADDGMFTFETVKPG
RVPFHDGRLMAPHISFWIVARGINIGLHTRMYFPDEAVANAADPLLARIEHRHRAETLVA
AGRTPNYVFDIHLQGEKETVFLDI
Download sequence
Identical sequences A6UH84
gi|150376351|ref|YP_001312947.1|NC_009620 WP_011969836.1.7720 YP_001312947.1.44884 366394.Smed_4209 gi|150376351|ref|YP_001312947.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]