SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150376497|ref|YP_001313093.1|NC_009620 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150376497|ref|YP_001313093.1|NC_009620
Domain Number 1 Region: 32-247
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 2.78e-27
Family NodB-like polysaccharide deacetylase 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150376497|ref|YP_001313093.1|NC_009620
Sequence length 251
Comment polysaccharide deacetylase [Sinorhizobium medicae WSM419 plasmid pSMED01]
Sequence
MLERQSRIGPLVDRLANRAIWKLARSRRLLETDVPLVSFTFDDVPDSALGAGAAVLEKYE
ARGTFYIAGGLAGQVEPDRRLITPEGCGELLARGHEIGCHTFSHRRLRDIAGLGADLDRN
DAYLKRVGVSPGASNFAFPYNAAWPSARAELRRRYRTCRAAGEAINRGAVDPMMLKGVEI
RQPEHEARALTSWIDDVVERPGWLIFFTHDIAMQPTSYGCTPETFDHLVRYAVEKGCCIL
RVDSAADRIGW
Download sequence
Identical sequences A6UHN0
gi|150376497|ref|YP_001313093.1| 366394.Smed_4355 WP_012061294.1.29075 WP_012061294.1.31871 WP_012061294.1.61285 WP_012061294.1.7720 WP_012061294.1.89664 YP_001313093.1.44884 gi|150376497|ref|YP_001313093.1|NC_009620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]