SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150376648|ref|YP_001313244.1|NC_009620 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150376648|ref|YP_001313244.1|NC_009620
Domain Number 1 Region: 22-66,98-321
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 8.34e-31
Family NodB-like polysaccharide deacetylase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|150376648|ref|YP_001313244.1|NC_009620
Sequence length 332
Comment hypothetical protein Smed_4511 [Sinorhizobium medicae WSM419 plasmid pSMED01]
Sequence
MIRISLALSVALFPALALADPPSARQLPKQLVVISFDGAHDNALWQKSLTMGKRTGARFT
YFLSCTFLMTRADGKQTYRAPGQKPGRSNVGFAQSREDIAMRAGHVWQAHLAGHEIGSHA
CGHFDGKDWSKADWASEFSAFRAALANAWKRAGKPEAEPEGWADFAQGGIKGFRAPYLSL
SDGLVPALKTFGFSYDASLVTKGPGWPSFADGLIRFGLPLIPEGPSHRPVIGMDYNLFVR
HSMGVENSRDSARFEERTLAAFRNAFRKEYEGERIPLQLGFHFVEMNGGAYWRALDGFLS
ETCSKPDVACVSYAEALPLIENARKKADRSAF
Download sequence
Identical sequences A6UI31
YP_001313244.1.44884 gi|150376648|ref|YP_001313244.1|NC_009620 gi|150376648|ref|YP_001313244.1| 366394.Smed_4511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]