SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|150378197|ref|YP_001314792.1|NC_009621 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|150378197|ref|YP_001314792.1|NC_009621
Domain Number 1 Region: 235-292,322-494
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 0.0000654
Family DeoB catalytic domain-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|150378197|ref|YP_001314792.1|NC_009621
Sequence length 553
Comment NoeB host specific nodulation protein [Sinorhizobium medicae WSM419 plasmid pSMED02]
Sequence
MKRIVLLLSPLVILLSPIIDAFQGVYIDPRSDAGYAVIACVAIIGLALGMIATFCYKRGA
VGNVVTAGTLAVTLFLFGDLSYGVFWRLADHIGMGGAAALAFAGLVVLILVLFKLMAAVP
RMMAAFAVALLGSTVLDRGLITEASAEESAPAVIYIVTDEMIGISGIDTRLPHGAEAKAA
LSRVFQKHGFRLHSKAFSRHILTQVSVPAALNMDYSYNFPGDRSHYAYPGEVTKFKELSL
FNLWHRQGLSVNVFQSAHLDYCKTEALVDCHTFASFDGSRFIQRQRIEGGPYRDVPPASA
SLADVKALIEGNRQSLAMAAVGFVASNLLETKETALQEWHPRSYDQLAFPYWLGQFQNMI
LDKGRGNAFFAHFLFPHSPSVYNKDCKPTNRWVERSYLTEVRGLAGQELDEARVKEYGFY
FAQTLCLAKQLDKFFNAVLSDKRFQDATIVVHGDHGSRISAGRNVETMSPRDYVDNYSAL
YAVRKPGVATGTDYRLHSVQWLNASLFRGNVSEVAPTVVGSMQSKSDDSALYAPITDPDH
VAIMPMHDFDASH
Download sequence
Identical sequences A6UMH9
YP_001314792.1.44884 gi|150378197|ref|YP_001314792.1|NC_009621 366394.Smed_6260 gi|150378197|ref|YP_001314792.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]