SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|158339913|ref|YP_001521083.1|NC_009927 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|158339913|ref|YP_001521083.1|NC_009927
Domain Number 1 Region: 8-134
Classification Level Classification E-value
Superfamily YjgF-like 5.34e-26
Family YjgF/L-PSP 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|158339913|ref|YP_001521083.1|NC_009927
Sequence length 135
Comment endoribonuclease L-PSP [Acaryochloris marina MBIC11017 plasmid pREB2]
Sequence
MAPSLTYLNPASLPDASAFGYSQITIMEPGRLAFISGQVAWQSSGEAVPDSLTGQAELVV
KNAKAALDAVGASSEDIVMVRIYMVDLTPDRIEELMPHLLAMFDGAKPSLTGVGVAALAG
PELQLEIEMIARLPS
Download sequence
Identical sequences A8ZM00
gi|158339913|ref|YP_001521083.1|NC_009927 gi|158339913|ref|YP_001521083.1| WP_012166923.1.67183 329726.AM1_B0043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]