SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186687245|ref|YP_001870388.1|NC_010632 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186687245|ref|YP_001870388.1|NC_010632
Domain Number 1 Region: 5-189
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 7.98e-57
Family Methylesterase CheB, C-terminal domain 0.0000445
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|186687245|ref|YP_001870388.1|NC_010632
Sequence length 336
Comment CheB methylesterase [Nostoc punctiforme PCC 73102 plasmid pNPUN02]
Sequence
MLEHNIIVIGTSAGGVEALTYLVKHLPPDLKAAVIIVLHVSNHGTSVLPKILSRAGNLPA
SHAQDGEAIIHGRIYIAPPDYHLLVESVYLRLTRGPKENRHRPAIDTLFRSAARSYGQRA
IAVLLTGMLDDGTAGLVAIKMRGGVAIVQNPDDALHPDMPRNAIENVLDIDYIQPLSDIP
STLVALVNTPMKVEPENPIPDKMEFESSIVQLDLEAVKNEADRPGKPSIFGCPDCGGILW
ELEEGNLLRFRCRTGHAFSAETLLATQSDKVEDALWIAFRALEEKASLSHRMALRMEEHN
QALAAKRFKEQAESAWQHSAIIREILLKADTSTGVD
Download sequence
Identical sequences B2JBP3
WP_012413351.1.44837 gi|186687245|ref|YP_001870388.1|NC_010632 63737.Npun_BF231 gi|186687245|ref|YP_001870388.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]