SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|206575595|ref|YP_002235780.1|NC_011282 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|206575595|ref|YP_002235780.1|NC_011282
Domain Number 1 Region: 8-106
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 2.48e-33
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|206575595|ref|YP_002235780.1|NC_011282
Sequence length 110
Comment PTS system, lactose/cellobiose specific IIA subunit [Klebsiella pneumoniae 342 plasmid pKP187]
Sequence
MDFDEDSMLDTEEVVMGIIVNAGHSRSLCYEALNHAKAGDFDHASKLLEMAAEAGKEAHA
IQTKLIEEDEGMGKTTMTLVMVHAQDHLMTSILCREMITELVQIYKSKLN
Download sequence
Identical sequences B5RK56
gi|206575595|ref|YP_002235780.1| WP_012540146.1.55984 WP_012540146.1.6018 507522.KPK_A0132 gi|206575595|ref|YP_002235780.1|NC_011282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]