SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|219718461|ref|YP_002474184.1|NC_011840 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219718461|ref|YP_002474184.1|NC_011840
Domain Number 1 Region: 12-108
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 4.18e-26
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|219718461|ref|YP_002474184.1|NC_011840
Sequence length 115
Comment PTS system, cellobiose-specific IIA component [Borrelia garinii PBr plasmid PBr_cp26]
Sequence
MNNKIYSIEELIDKISMPVVAYAGEAKSFLREALEYAKNKDYEKADLSIQESRNSIAKAH
EAHREIIKQSATNPSSVKPPFILIHAEDHLMSAISELSIFEELINVYKIINEIKK
Download sequence
Identical sequences B8F153
WP_012621134.1.20234 WP_012621134.1.21215 WP_012621134.1.23943 WP_012621134.1.25093 WP_012621134.1.27233 WP_012621134.1.47313 WP_012621134.1.52841 WP_012621134.1.70007 WP_012621134.1.73345 WP_012621134.1.89341 WP_012621134.1.93467 WP_012621134.1.99151 gi|219718461|ref|YP_002474184.1|NC_011840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]