SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222102116|ref|YP_002546706.1|NC_011987 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222102116|ref|YP_002546706.1|NC_011987
Domain Number 1 Region: 130-369
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.97e-60
Family D-glucarate dehydratase-like 0.000000902
Further Details:      
 
Domain Number 2 Region: 5-131
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.41e-33
Family Enolase N-terminal domain-like 0.00000852
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|222102116|ref|YP_002546706.1|NC_011987
Sequence length 383
Comment Mandelate racemase/muconate lactonizing enzyme [Agrobacterium radiobacter K84 plasmid pAtK84c]
Sequence
MSGIIRITAIETIILDLPTIRPHKLSMVTMSQQSMTIVRIRCSDDFEGTGEGTTIGGLAY
GPESPEGMKLTIDQYVAPLLIGRDATRVQAAMDIVSKAIKGNHFAKCAVETALLDCHARR
LGLPLSELLGGRRRDSLPIAWTLASGDTARDVDEAQQMLDLRRHKDFKLKIGSKPIAEDV
RHVADIRKALPDTASIRVDVNMAWREREAKGAIDALADAGCVLVEQPVAGIAPLARLTRA
SSIAIMADEALVGPESALEAATARAADVFSIKIEQAGGLFAAAKVIAIAETAGISIYGGT
MLEGPVGTIAASQLLVGVTDLPWGTEFFGPLLLTEELLIEPLVFRDFELQIPTGPGLGIT
LDESAVDRFRRGAKPAGGLRIAG
Download sequence
Identical sequences B9JQ23
gi|222102116|ref|YP_002546706.1|NC_011987 311403.Arad_12213 gi|222102116|ref|YP_002546706.1| WP_012653236.1.91008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]