SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|224586464|ref|YP_002640353.1|NC_012129 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|224586464|ref|YP_002640353.1|NC_012129
Domain Number 1 Region: 12-108
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 4.58e-26
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|224586464|ref|YP_002640353.1|NC_012129
Sequence length 115
Comment PTS system, cellobiose-specific IIA component [Borrelia valaisiana VS116 plasmid VS116_cp26]
Sequence
MNKKTYSIEELIDKISMPVVAYSGEAKSFLREALEHAKNKDYEKAELAIQESKNSISKAH
ETHREIIQQSTTNPSSIKIPFILIHAEDHLMSAISELSIFEELINVYKIINEIKK
Download sequence
Identical sequences C0R818
gi|224586464|ref|YP_002640353.1|NC_012129 WP_012664745.1.24739 WP_012664745.1.99709 gi|224586464|ref|YP_002640353.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]