SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|224586552|ref|YP_002640437.1|NC_012132 from NCBI plasmid sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|224586552|ref|YP_002640437.1|NC_012132
Domain Number 1 Region: 12-108
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 3.79e-26
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|224586552|ref|YP_002640437.1|NC_012132
Sequence length 115
Comment PTS system cellobiose-specific transporter subunit IIA [Borrelia spielmanii A14S plasmid A14S_cp26]
Sequence
MNKKIYSIEELIDKISMPVVAYSGEAKSFLREALEYAKNKDYEKAALTIQESKNSIAKAH
ETHREIIQQSATNPDSVKTPFILIHAEDHLMSAISELSIFEELINVYKIINEIKK
Download sequence
Identical sequences C0RBV5
gi|224586552|ref|YP_002640437.1|NC_012132 WP_012664825.1.12897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]